DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31249 and Rtraf

DIOPT Version :9

Sequence 1:NP_732262.1 Gene:CG31249 / 42129 FlyBaseID:FBgn0051249 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_080804.1 Gene:Rtraf / 68045 MGIID:1915295 Length:244 Species:Mus musculus


Alignment Length:230 Identity:90/230 - (39%)
Similarity:137/230 - (59%) Gaps:11/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DRKEFANTVLWLEDQKIRLYSIEDRCKLRTVDNPEIWKEGYLKYCADLSMP-PLETRQEQLAWIV 87
            |..||.|.::||||||||.|.||||..||.:.:.: |.:.:.||..|::.| .::.|||.:.|::
Mouse    21 DETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSD-WPKFFEKYLKDVNCPFKIQDRQEAIDWLL 84

  Fly    88 SYAVRLDFLDDPDQFASINTKQVPP-QSNGKQSQQRVQAIFDGNINTQEKAFVDGVRLLASKLNV 151
            ..||||::.|:.:::..:    ||. :.|...:.:..:.:.:.::|..:  |..||..||:.|.:
Mouse    85 GLAVRLEYGDNAEKYKDL----VPDNRKNTDNAAKNAEPLINLDVNNPD--FKAGVMALANLLQI 143

  Fly   152 PHHPNHLLQLEAIARVVHERLS--PAAKDRKPVVGKPFPFDKGNDVVSSNDSALDLPMRILRLLQ 214
            ..|.::|:.|:||..:|.|||:  ..||..:...|.|...:|......:.|:.|:...:|||||.
Mouse   144 QRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALEKHILGFDTGDAVLNEAAQILRLLH 208

  Fly   215 IQSLRELQTHINETIVAVQNITANPKTDTKLGKVG 249
            |:.||||||.|||.|||||.|.|:||||.:|||||
Mouse   209 IEELRELQTKINEAIVAVQAIIADPKTDHRLGKVG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31249NP_732262.1 RLL 7..249 CDD:287054 88/228 (39%)
RtrafNP_080804.1 RLL 8..243 CDD:401864 88/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840819
Domainoid 1 1.000 146 1.000 Domainoid score I4546
eggNOG 1 0.900 - - E1_KOG4380
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9355
Inparanoid 1 1.050 146 1.000 Inparanoid score I4406
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59794
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005794
OrthoInspector 1 1.000 - - oto92182
orthoMCL 1 0.900 - - OOG6_105549
Panther 1 1.100 - - LDO PTHR15924
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2943
SonicParanoid 1 1.000 - - X5512
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.