DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31249 and RTRAF

DIOPT Version :9

Sequence 1:NP_732262.1 Gene:CG31249 / 42129 FlyBaseID:FBgn0051249 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_057123.1 Gene:RTRAF / 51637 HGNCID:23169 Length:244 Species:Homo sapiens


Alignment Length:230 Identity:91/230 - (39%)
Similarity:136/230 - (59%) Gaps:11/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DRKEFANTVLWLEDQKIRLYSIEDRCKLRTVDNPEIWKEGYLKYCADLSMP-PLETRQEQLAWIV 87
            |..||.|.::||||||||.|.||||..||.:.:.: |.:.:.||..|::.| .::.|||.:.|::
Human    21 DETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSD-WPKFFEKYLRDVNCPFKIQDRQEAIDWLL 84

  Fly    88 SYAVRLDFLDDPDQFASINTKQVPPQS-NGKQSQQRVQAIFDGNINTQEKAFVDGVRLLASKLNV 151
            ..||||::.|:.:::..:    ||..| ....:.:..:.:.:.::|..:  |..||..||:.|.:
Human    85 GLAVRLEYGDNAEKYKDL----VPDNSKTADNATKNAEPLINLDVNNPD--FKAGVMALANLLQI 143

  Fly   152 PHHPNHLLQLEAIARVVHERLS--PAAKDRKPVVGKPFPFDKGNDVVSSNDSALDLPMRILRLLQ 214
            ..|.::|:.|:||..:|.|||:  ..||..:...|.|...||......:.|:.|:...:|||||.
Human   144 QRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLH 208

  Fly   215 IQSLRELQTHINETIVAVQNITANPKTDTKLGKVG 249
            |:.||||||.|||.|||||.|.|:||||.:|||||
Human   209 IEELRELQTKINEAIVAVQAIIADPKTDHRLGKVG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31249NP_732262.1 RLL 7..249 CDD:287054 89/228 (39%)
RTRAFNP_057123.1 RLL 8..243 CDD:401864 89/228 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150740
Domainoid 1 1.000 148 1.000 Domainoid score I4494
eggNOG 1 0.900 - - E1_KOG4380
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9355
Inparanoid 1 1.050 148 1.000 Inparanoid score I4409
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59794
OrthoDB 1 1.010 - - D1239557at2759
OrthoFinder 1 1.000 - - FOG0005794
OrthoInspector 1 1.000 - - oto88618
orthoMCL 1 0.900 - - OOG6_105549
Panther 1 1.100 - - LDO PTHR15924
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2943
SonicParanoid 1 1.000 - - X5512
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.