DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31249 and CG31251

DIOPT Version :9

Sequence 1:NP_732262.1 Gene:CG31249 / 42129 FlyBaseID:FBgn0051249 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_732260.2 Gene:CG31251 / 318645 FlyBaseID:FBgn0051251 Length:306 Species:Drosophila melanogaster


Alignment Length:196 Identity:33/196 - (16%)
Similarity:64/196 - (32%) Gaps:54/196 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VRLDFLDDPDQFASINTKQVPPQSNGKQSQ-----------------------QRVQAIFDGNIN 132
            |.|:..|.|........:..|||...:||:                       ..|||:...:..
  Fly    94 VVLESEDGPQDEEMKPIESQPPQKGKEQSKFSPSDYKNGDVFETHCWSQTLKDVEVQALLPKDHQ 158

  Fly   133 TQEKAFVDGVRLLASKLNVPHHPNH-LLQLEAIARVVHERLSPAAKDRKPVVGKPFPFDKGN--- 193
            |.:|..: .::....|::..|.|.. :|:.....|:.|:.........:.::.    :||..   
  Fly   159 TAKKLHI-SIQAQHIKVSSKHSPETIILEGNLSQRIKHKEAVWTIDQNRLIIS----YDKAKELW 218

  Fly   194 -DVVSSNDSAL------------DLP---------MRILRLLQIQSLRELQTHINETIVAVQNIT 236
             |.:...|..:            |||         :|:.:|...:...|:||...:..:.:..:.
  Fly   219 WDRLFEGDPEIDSKKIECERYIDDLPEETQATIEKLRVQQLAADKQQNEIQTSSPDQAINLDRLK 283

  Fly   237 A 237
            |
  Fly   284 A 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31249NP_732262.1 RLL 7..249 CDD:287054 33/196 (17%)
CG31251NP_732260.2 Nudc_N 5..64 CDD:290757
p23_NUDC_like 139..223 CDD:107224 14/88 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4380
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.