DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31249 and E02H1.5

DIOPT Version :9

Sequence 1:NP_732262.1 Gene:CG31249 / 42129 FlyBaseID:FBgn0051249 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001369864.1 Gene:E02H1.5 / 174510 WormBaseID:WBGene00008457 Length:253 Species:Caenorhabditis elegans


Alignment Length:252 Identity:54/252 - (21%)
Similarity:107/252 - (42%) Gaps:57/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDQKIR--LYSIED---RCK-----LRTVDNPEI--WKEGYLKYCADLSMPPLETRQEQLAWIVS 88
            :|.:||  :.::|:   :|:     .:.:|..::  |.....||..:...|...:|...:.::::
 Worm    20 DDNEIRRLIVTVEEAHLKCRDQNWSAQMLDEQDVAKWTVELEKYFTEFGAPSGCSRAAAIDYVLN 84

  Fly    89 YAVRLDFLDDPDQFASINTKQVPPQSNGK----QSQQRVQA--IFDGNINTQEKA---------F 138
            .||                :::..|..|.    .|:.|.||  :.:.:.::|...         |
 Worm    85 AAV----------------QKIYEQKGGDTELCSSRLREQAEKVLEAHRDSQNPLNRLDYSSPNF 133

  Fly   139 VDGVRLLASKLNV-PHHPNHLLQLEA----IAR-----VVHERLSPAAKDRKPVVGKPFPFDKGN 193
            .:..|.|.|.|.: .|||:..:.::|    ||.     |:.|......|::|.:....||.    
 Worm   134 AENARALCSILGISAHHPDPKVLMKAACLYIAENLGDDVIAEETEEVLKNKKTLNINAFPI---- 194

  Fly   194 DVVSSNDSALDLPMRILRLLQIQSLRELQTHINETIVAVQNITANPKTDTKLGKVGF 250
            .:.:..:.|:....|:|||:.::.||.:...||||:|.:||:|.:......|.:|.:
 Worm   195 GMQAPKNGAVHFSARLLRLICLRQLRVVSRMINETLVEIQNLTMDMSKRADLKQVQY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31249NP_732262.1 RLL 7..249 CDD:287054 53/249 (21%)
E02H1.5NP_001369864.1 RLL 8..249 CDD:401864 53/248 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161682
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4380
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59794
OrthoDB 1 1.010 - - D1239557at2759
OrthoFinder 1 1.000 - - FOG0005794
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105549
Panther 1 1.100 - - LDO PTHR15924
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2943
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.