DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mps1 and Tlk

DIOPT Version :9

Sequence 1:NP_001262677.1 Gene:Mps1 / 42126 FlyBaseID:FBgn0000063 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001138153.1 Gene:Tlk / 318206 FlyBaseID:FBgn0283657 Length:1489 Species:Drosophila melanogaster


Alignment Length:360 Identity:97/360 - (26%)
Similarity:142/360 - (39%) Gaps:84/360 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 IKNHEYTIDKKLGCGGSSSVFLARRSDSGNEFALKVVDLQAD------PQVVQGYLNETKLLAKL 390
            :.|..|.:...||.||.|.|..|.........|.||..|..|      ...::..|.|.. :.|.
  Fly  1145 VLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLNKDWKEDKKANYIKHALREYN-IHKA 1208

  Fly   391 QGNVCVVALYD-YQLVREESKLYMVMEKGD-CDLNKILQSYTTNLPLYSLMNILYQMLQAVNYIH 453
            ..:..||.||| :::  :.:....|:|..| .||:..|:.:.| :|.....:|:.|::.|:.|::
  Fly  1209 LDHPRVVKLYDVFEI--DANSFCTVLEYCDGHDLDFYLKQHKT-IPEREARSIIMQVVSALKYLN 1270

  Fly   454 Q--HGVIHSDLKPANFLM----VSGRLKLIDFGIA-----SNIAVDSTSIIKFSQAGTFNYISPE 507
            :  ..|||.||||.|.|:    |.|.:|:.|||::     .|...|....:....|||:.|:.||
  Fly  1271 EIKPPVIHYDLKPGNILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPPE 1335

  Fly   508 ALTDTSTGNSPMRRADQPKIKISTKSDVWSLGCILYLLLYQKTPFGHIRNVYAKMSAITTPGTSI 572
            ...   .|.:|.        |||:|.||||:|.|.|..||.|.||||      ..|..|      
  Fly  1336 CFV---VGKNPP--------KISSKVDVWSVGVIFYQCLYGKKPFGH------NQSQAT------ 1377

  Fly   573 EYPAIPPYYPIMLVHFTTVSALFADGQELPTVESQKAAVV-------------------HRTTTV 618
                       :|...|.:.|........|||.::..:.:                   |.....
  Fly  1378 -----------ILEENTILKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQP 1431

  Fly   619 PIP--------YDHSAAEPADTQQNRQQQLSTKAQ 645
            |||        ....|.:....||.:|||.|:.:|
  Fly  1432 PIPKHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQ 1466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mps1NP_001262677.1 PKc_Mps1 335..579 CDD:271033 78/262 (30%)
S_TKc 337..575 CDD:214567 78/256 (30%)
TlkNP_001138153.1 S_TKc 1161..1429 CDD:214567 80/305 (26%)
STKc_TLK 1161..1428 CDD:270892 80/304 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472988
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22974
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.