DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mps1 and TTBK2

DIOPT Version :9

Sequence 1:NP_001262677.1 Gene:Mps1 / 42126 FlyBaseID:FBgn0000063 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_005254228.1 Gene:TTBK2 / 146057 HGNCID:19141 Length:1250 Species:Homo sapiens


Alignment Length:252 Identity:58/252 - (23%)
Similarity:99/252 - (39%) Gaps:51/252 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 YMVMEKGDCDLNKILQSYTT-NLPLYSLMNILYQMLQAVNYIHQHGVIHSDLKPANFLMVSGRLK 475
            |:||:....:|..:.:|.:. ...:.:.:.:..|:|:::..||..|.:|.|:||:||.|  ||..
Human    97 YVVMQLQGRNLADLRRSQSRGTFTISTTLRLGRQILESIESIHSVGFLHRDIKPSNFAM--GRFP 159

  Fly   476 -------LIDFGIASNIAVDSTSIIKFSQA-----GTFNYISPEALTDTSTGNSPMRRADQPKIK 528
                   ::|||:|... .:|...::..:|     ||..|.|..|     ..|..|.|.|     
Human   160 STCRKCYMLDFGLARQF-TNSCGDVRPPRAVAGFRGTVRYASINA-----HRNREMGRHD----- 213

  Fly   529 ISTKSDVWSLGCILYLLLYQKTPFGHIRNVYAKMSAITTPGTSIEYPAIPPYYPIMLVHFTTVSA 593
                 |:|||..:|...:..:.|:..|::.....|........:....:||.:.|.|.|.:::..
Human   214 -----DLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKERYDHRLMLKHLPPEFSIFLDHISSLDY 273

  Fly   594 LFADGQELPT------------VESQ--------KAAVVHRTTTVPIPYDHSAAEPA 630
            ......:|.|            :||.        ....:..|||...|..|:...||
Human   274 FTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKTGNDGSLTTTTTSTTPQLHTRLTPA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mps1NP_001262677.1 PKc_Mps1 335..579 CDD:271033 42/179 (23%)
S_TKc 337..575 CDD:214567 42/175 (24%)
TTBK2XP_005254228.1 PKc_like 75..287 CDD:304357 49/207 (24%)
SPS1 78..>267 CDD:223589 46/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3763
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.