DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AttD and AttB

DIOPT Version :9

Sequence 1:NP_524391.2 Gene:AttD / 42122 FlyBaseID:FBgn0038530 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001163152.1 Gene:AttB / 36637 FlyBaseID:FBgn0041581 Length:218 Species:Drosophila melanogaster


Alignment Length:183 Identity:60/183 - (32%)
Similarity:83/183 - (45%) Gaps:8/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SGNPKSGA-ATAQCGVRVGDDLANARAGVFASTPGAGGPVTKGVYGAVNANGHALSLQHGHIEGV 69
            :.||..|| |.......:|:...|....|||:.....||||.|...|.|..||..||...|..||
  Fly    36 ASNPAGGADARLNLSKGIGNPNHNVVGQVFAAGNTQSGPVTTGGTLAYNNAGHGASLTKTH
TPGV 100

  Fly    70 GSTTTAAAQANLFQSNNAALNATAFHSHSRSHDQF-----GGGLNLQTGTGHQAAVGVTRVPQFG 129
            .......|.||||.:....|:|..|.|.::..:.|     |.||:.....||..::..:..|..|
  Fly   101 KDVFQQEAHANLFNNGRHNLDAKVFASQNKLANGFEFQRNGAGLDYSHINGHGGSLTHSNFPGIG 165

  Fly   130 MTAVQASGTANLYTSPSGNLNLNATGSANHHLRGPMRG-KSDFGTGVNLRYNF 181
            . .:...|.|||::||:....|:.||||:....||... |.:||.|:.|.::|
  Fly   166 Q-QLGLDGRANLWSSPNRATTLDLTGSASKWTSGPFANQKPNFGAGLGLSHHF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AttDNP_524391.2 Attacin_N 1..65 CDD:281725 21/59 (36%)
Attacin_C 67..181 CDD:281726 37/119 (31%)
AttBNP_001163152.1 Attacin_N 31..96 CDD:281725 21/59 (36%)
Attacin_C 98..217 CDD:281726 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.