DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AttD and AttA

DIOPT Version :9

Sequence 1:NP_524391.2 Gene:AttD / 42122 FlyBaseID:FBgn0038530 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_523745.1 Gene:AttA / 36636 FlyBaseID:FBgn0012042 Length:221 Species:Drosophila melanogaster


Alignment Length:183 Identity:61/183 - (33%)
Similarity:84/183 - (45%) Gaps:8/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SGNPKSGA-ATAQCGVRVGDDLANARAGVFASTPGAGGPVTKGVYGAVNANGHALSLQHGHIEGV 69
            :.||..|| |.......:|:...|....|||:.....||||.|...|.|..||..||...|..||
  Fly    39 TSNPAGGADARLDLTKGIGNPNHNVVGQVFAAGNTQSGPVTTGGTLAYNNAGHGASLTKTH
TPGV 103

  Fly    70 GSTTTAAAQANLFQSNNAALNATAFHSHSRSHDQF-----GGGLNLQTGTGHQAAVGVTRVPQFG 129
            .......|.||||.:....|:|..|.|.::..:.|     |.||:.....||.|::..:..|..|
  Fly   104 KDVFQQEAHANLFNNGRHNLDAKVFASQNKLANGFEFQRNGAGLDYSHINGHGASLTHSNFPGIG 168

  Fly   130 MTAVQASGTANLYTSPSGNLNLNATGSANHHLRGPMRG-KSDFGTGVNLRYNF 181
            . .:...|.|||::||:....|:.||||:....||... |.:||.|:.|.::|
  Fly   169 Q-QLGLDGRANLWSSPNRATTLDLTGSASKWTSGPFANQKPNFGAGLGLSHHF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AttDNP_524391.2 Attacin_N 1..65 CDD:281725 21/59 (36%)
Attacin_C 67..181 CDD:281726 38/119 (32%)
AttANP_523745.1 Attacin_N 34..99 CDD:281725 21/59 (36%)
Attacin_C 101..220 CDD:281726 38/119 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.