DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AttD and AttC

DIOPT Version :9

Sequence 1:NP_524391.2 Gene:AttD / 42122 FlyBaseID:FBgn0038530 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_523729.3 Gene:AttC / 36484 FlyBaseID:FBgn0041579 Length:241 Species:Drosophila melanogaster


Alignment Length:186 Identity:56/186 - (30%)
Similarity:80/186 - (43%) Gaps:11/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SGNPKSGA-ATAQCGVRVGDDLANARAGVFAS----TPGAGGPVTKGVYGAVNANGHALSLQHGH 65
            :.||..|| |.......||....:....|||:    |.....|||.|.....|.:||.|.|...|
  Fly    56 TSNPSGGADARLDLSKAVGTPDHHVIGQVFAAGNTQTKPVSTPVTSGATLGYNNHGHGLELTKTH 120

  Fly    66 IEGVGSTTTAAAQANLFQSNNAALNATAFHSHSR-----SHDQFGGGLNLQTGTGHQAAVGVTRV 125
            ..||..:....|.||||.:....|:|.||.|.::     ..|:.|..|:.....||.|.:....:
  Fly   121 TPGVRDSFQQTATANLFNNGVHNLDAKAFASQNQLANGFKFDRNGAALDYSHVKGHGATLTHANI 185

  Fly   126 PQFGMTAVQASGTANLYTSPSGNLNLNATGSANHHLRGPMRGKSDFGTGVNLRYNF 181
            |..| ..::..|.|||:.|...|..|:...:|:....||.:|::|.|..:.|.:.|
  Fly   186 PGLG-KQLELGGRANLWQSQDRNTRLDLGSTASKWTSGPFKGQTDLGANLGLSHYF 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AttDNP_524391.2 Attacin_N 1..65 CDD:281725 20/63 (32%)
Attacin_C 67..181 CDD:281726 34/118 (29%)
AttCNP_523729.3 Attacin_N 51..120 CDD:281725 20/63 (32%)
Attacin_C 122..240 CDD:281726 34/118 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.