DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sll and UTR3

DIOPT Version :9

Sequence 1:NP_001247153.1 Gene:sll / 42115 FlyBaseID:FBgn0038524 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_563949.1 Gene:UTR3 / 837998 AraportID:AT1G14360 Length:331 Species:Arabidopsis thaliana


Alignment Length:323 Identity:96/323 - (29%)
Similarity:168/323 - (52%) Gaps:14/323 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 LLWCFGGLMISYLTWGVLQEKIMTQNYLNFTGESAK-FKDSQFLVFSNRLLAFLVALAYLQWQPS 208
            |.:|..|:..:|:..|:|||.:.|:.:    ||..| |:...||..:..::..:.:...::...:
plant    14 LSFCVAGIWAAYIYQGILQETLSTKKF----GEDGKRFEHLAFLNLAQNVICLVWSYIMIKLWSN 74

  Fly   209 PVRHRAPLYKYSYASFSNIMSAWFQYEALKFVNFPTQVLAKSCKIIPVMLMGKIMSKAKYESYEY 273
            .....||.:.|..|..:|.:......||||::::|.||||||.|:|||||||.::...:|...||
plant    75 GGSGGAPWWTYWSAGITNTIGPAMGIEALKYISYPAQVLAKSSKMIPVMLMGSLVYGIRYTLPEY 139

  Fly   274 VTALLISLGMIFF---MSGSSDSSKASGVTTLTGIFLLSMYMVFDSFTANWQGSLFKSYGMT-PL 334
            :...|::.|:..|   .:.|...||.:......|..|..:.:.||.||...|.|:...|..| ..
plant   140 LCTFLVAGGVSMFALLKTSSKTISKLAHPNAPLGYGLCFLNLAFDGFTNATQDSITARYPKTNAW 204

  Fly   335 QMMCGVNLFSSIFTGA---SLSMQGGFMDSLAFATEHPKFVFDMVVLSVCSAVGQLFIYHTIDVF 396
            .:|.|:||:.:|:...   .|....|| :::.|..:||:..:|:::..:|.||||.||:.||..|
plant   205 DIMLGMNLWGTIYNMVYMFGLPHGSGF-EAVQFCKQHPEAAWDILMYCLCGAVGQNFIFLTISRF 268

  Fly   397 GPVVFTIIMTLRQAVAIMLSCFIYQHSISLLGIFGVLIVFVAIFLRVYCT-QRLRAIRKRAEA 458
            |.:..|.|.|.|:.|:|::|..:..:.:|......|.:||..:..::|.. ::|:.::|:.:|
plant   269 GSLANTTITTTRKFVSIVVSSVLSGNPLSSKQWGCVSMVFGGLSYQIYLKWRKLQRMQKKKKA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sllNP_001247153.1 UAA 144..444 CDD:285625 92/306 (30%)
UTR3NP_563949.1 UAA 16..318 CDD:312076 92/306 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54403
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.