DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sll and SLC35B3

DIOPT Version :9

Sequence 1:NP_001247153.1 Gene:sll / 42115 FlyBaseID:FBgn0038524 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001136012.1 Gene:SLC35B3 / 51000 HGNCID:21601 Length:401 Species:Homo sapiens


Alignment Length:397 Identity:96/397 - (24%)
Similarity:164/397 - (41%) Gaps:61/397 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TGNSGYDQLDAGTSTAD----KDRPAAS-TAPKRTSS---------------------QEAVQLL 146
            |..:..:.::....|.|    ..|...| |.|.:|.:                     .:..|..
Human    18 TNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNKLTQFF 82

  Fly   147 WCFGGLMISYLTWGVLQEKIMTQN-------YLNFTGESAKFKDSQFLVFSNRLLAFLVALAYLQ 204
            .|..|:.:.||.:|.|||.|.:..       ||...         ||..:|   :..|:.|..:|
Human    83 ICVAGVFVFYLIYGYLQELIFSVEGFKSCGWYLTLV---------QFAFYS---IFGLIELQLIQ 135

  Fly   205 WQPSPVRHRAPLYKYSYASFSNIMSAWFQYEALKFVNFPTQVLAKSCKIIPVMLMGKIMSKAKYE 269
                ..|.|.|...|...:|..:.:......:|.::|:||||:.|.||:|||||.|..:...:|.
Human   136 ----DKRRRIPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQGKRYN 196

  Fly   270 SYEYVTALLISLGMIFFMSGSSDSSKASGVTTLTGIFLLSMYMVFDSFTANWQGSLFKSYGMTPL 334
            ..:...|:.:|||:|:|.  .:||:.|... .|||:.|:|:.:..|:...|.|....|.:..:..
Human   197 VADVSAAICMSLGLIWFT--LADSTTAPNF-NLTGVVLISLALCADAVIGNVQEKAMKLHNASNS 258

  Fly   335 QMMCGVNLFSSIFTGASLSMQGGFMDSLAFATEHPKFVFDMVVL-SVCSAVGQLFIYHTIDVFGP 398
            :|:........::....|:...|...::.|..::|...:....| |:....|..|:...|.:||.
Human   259 EMVLYSYSIGFVYILLGLTCTSGLGPAVTFCAKNPVRTYGYAFLFSLTGYFGISFVLALIKIFGA 323

  Fly   399 VVFTIIMTLRQAVAIMLSCFIYQHSISLLGIFGVLIVFVAIFLRVYC--TQRLR------AIRKR 455
            ::...:.|.|:|:.|:||...:....:...::..|:|.:.|||.||.  ..::|      .|.|.
Human   324 LIAVTVTTGRKAMTIVLSFIFFAKPFTFQYVWSGLLVVLGIFLNVYSKNMDKIRLPSLYDLINKS 388

  Fly   456 AEANKPK 462
            .||.|.:
Human   389 VEARKSR 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sllNP_001247153.1 UAA 144..444 CDD:285625 80/307 (26%)
SLC35B3NP_001136012.1 UAA 80..371 CDD:312076 82/309 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.