DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sll and CG14511

DIOPT Version :9

Sequence 1:NP_001247153.1 Gene:sll / 42115 FlyBaseID:FBgn0038524 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_651675.1 Gene:CG14511 / 43445 FlyBaseID:FBgn0039641 Length:322 Species:Drosophila melanogaster


Alignment Length:294 Identity:61/294 - (20%)
Similarity:112/294 - (38%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 SAKFKDSQFLVFSNRLLAFLVALAYLQWQPSPVRHRAPLYKYSYASFSNIMSAWFQYEALKF-VN 241
            ::||..:| .|.|.|..|.|||:.:|                  .|..|      .| ..|| |.
  Fly    55 TSKFGLAQ-RVISLRDYALLVAMFFL------------------TSVCN------NY-VFKFKVP 93

  Fly   242 FPTQVLAKSCKIIPVMLMGKIMSKAKYESYEYVTALLISLGMI---FF--------MSGSSDSSK 295
            ....::.:...:|..|.:..::.|..|...:|::.|:||:|:.   :|        |......::
  Fly    94 MTLHMIIRGGSLISNMCLCTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKMENLDSGAE 158

  Fly   296 ASGVTTLTGIFLLSMYMVFDSFTANWQGSLFKSYGMTPLQMMCGVNLFSSIFTGASLSMQGGFMD 360
            |.....|.|:.||.:.:...|:....|..|::.:|....:.:...:|..   ..|.|.|......
  Fly   159 ADTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREALYYTHLLP---LPAFLLMHDDIRT 220

  Fly   361 S--LAFATEHPKFVFDMVVLSVCSAVGQLFIYHTIDVF----------------GPVVFTIIMTL 407
            .  |||..|.    :.:.:|.|  ||..:.:|...:|.                ..:..|:|:||
  Fly   221 HWLLAFTGES----YQLPLLGV--AVPLILLYLLGNVLAQHLCISSVYTLTTECSSLTVTLILTL 279

  Fly   408 RQAVAIMLSCFIYQHSISLLGIFGVLIVFVAIFL 441
            |:.::::.|...:::..:.....|..:|||...:
  Fly   280 RKFISLVFSIVYFRNPFTWWHWLGTALVFVGTLM 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sllNP_001247153.1 UAA 144..444 CDD:285625 61/294 (21%)
CG14511NP_651675.1 UAA 6..318 CDD:285625 61/294 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10778
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.