DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sll and slc35b1

DIOPT Version :9

Sequence 1:NP_001247153.1 Gene:sll / 42115 FlyBaseID:FBgn0038524 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_989418.1 Gene:slc35b1 / 395058 XenbaseID:XB-GENE-972777 Length:342 Species:Xenopus tropicalis


Alignment Length:306 Identity:104/306 - (33%)
Similarity:159/306 - (51%) Gaps:16/306 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 QLLWCFGGLMISYLTWGVLQEKIMTQNYLNFTGE---SAKFKDSQFLVFSNRLLAFLVALAYLQW 205
            :||.||.|:.:.|..:|:|||.|....|    ||   ..||:.:..|||...::..|.|...:|:
 Frog    32 RLLVCFLGVFVCYFYYGILQETITRGTY----GEGEKQEKFRFALSLVFVQCIVNALFAKLLIQF 92

  Fly   206 QPSPVRHRAPLYKYSYASFSNIMSAWFQYEALKFVNFPTQVLAKSCKIIPVMLMGKIMSKAKYES 270
            ..|....|...:.|:..|.|.:.:......||:|||:|||||.||||.|||||:|..:.:.||..
 Frog    93 FDSGKTDRTQSWLYAACSLSYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLRKKYPL 157

  Fly   271 YEYVTALLISLGMIFFM-----SGSSDSSKASGVTTLTGIFLLSMYMVFDSFTANWQGSLFKSYG 330
            .:|:..|||.||:..||     :||.......|.    |..||.:.:..|..|...|..:...:.
 Frog   158 SKYLCVLLIVLGVALFMYKPKNTGSGGDEHTFGY----GELLLLLSLTLDGLTGVSQDHMRAHFQ 218

  Fly   331 MTPLQMMCGVNLFSSIFTGASLSMQGGFMDSLAFATEHPKFVFDMVVLSVCSAVGQLFIYHTIDV 395
            .....||..:||:||:|.||.:...|...|.|:|...:|..|:::::.|:.||:||.||:.|:..
 Frog   219 TGSNHMMLYINLWSSLFLGAGIVFTGELWDFLSFTERYPSIVYNIMLFSLTSALGQTFIFMTVVY 283

  Fly   396 FGPVVFTIIMTLRQAVAIMLSCFIYQHSISLLGIFGVLIVFVAIFL 441
            |||:..:||.|.|:...|:.|..::.:.||.:...|.::||:.:.|
 Frog   284 FGPLTCSIITTTRKFFTILASVILFSNPISSIQWVGTILVFLGLGL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sllNP_001247153.1 UAA 144..444 CDD:285625 104/306 (34%)
slc35b1NP_989418.1 UAA 32..329 CDD:285625 103/304 (34%)
EamA <225..329 CDD:304911 36/103 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54403
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R581
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.