DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sll and hut1

DIOPT Version :9

Sequence 1:NP_001247153.1 Gene:sll / 42115 FlyBaseID:FBgn0038524 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_595251.1 Gene:hut1 / 2541206 PomBaseID:SPBC839.11c Length:322 Species:Schizosaccharomyces pombe


Alignment Length:331 Identity:90/331 - (27%)
Similarity:160/331 - (48%) Gaps:32/331 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 QLLWCFGGLMISYLTWGVLQEKIMTQNYLNFTGESAKFKDSQFLVFSNRLLAFLVALAYLQW--- 205
            ||..|..|:..|:|:|.|:||||:|:.|     :..:|.....|..:.   :|:..|..|.|   
pombe     7 QLFVCMIGIYGSFLSWAVMQEKIITRPY-----DGERFSSPALLSLAQ---SFMTVLCGLLWNWF 63

  Fly   206 ---------QPSPVRHRAPLYKYSYASFSNIMSAWFQYEALKFVNFPTQVLAKSCKIIPVMLMGK 261
                     :|..:.:      :|..:.|..:|::|.|.::..:::||.:|.||||::||:.:..
pombe    64 HGVSARGLLEPKFLGY------FSSIAISASLSSYFGYASMFHLSYPTVILGKSCKLLPVIALHV 122

  Fly   262 IMSKAKYESYEYVTALLISLGMIFFMSGSSDSSKASGV--TTLTGIFLLSMYMVFDSFTANWQGS 324
            .:.|.|:..::|:...:|:.|:..|....:.|||....  .:..|:.||...::.|..|...|..
pombe   123 FVYKRKFPPHKYLIVTMITAGVSIFSYFQNTSSKGKHAEHDSPIGLLLLFFNLLMDGITNTTQDK 187

  Fly   325 LFKSYGMTPLQMMCGVNLFSSIFTGASLSMQGGFMDSLAFATEHPKFVFDMVVLSVCSAVGQLFI 389
            :|..|.::.:.||..|||..:...|..|.........|:|...||..:.||::.:...:||||||
pombe   188 VFGKYKLSSVTMMIAVNLGIACLNGLYLISPFCNQQPLSFINRHPSILKDMLLFACTGSVGQLFI 252

  Fly   390 YHTIDVFGPVVFTIIMTLRQAVAIMLSCFIYQHSISLLGIFGVLIVFVAIFLRVYCTQRLRAIRK 454
            :.|::.||.:....|...|:...::||.|.:.|::|.:...|:|:||:.|.|..    .|:.:..
pombe   253 FFTLEKFGSITLVTITLTRKIFTMLLSVFHFHHTVSSIQWLGILLVFLGISLEA----GLKILNN 313

  Fly   455 RAEANK 460
            .:.|.|
pombe   314 NSTAKK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sllNP_001247153.1 UAA 144..444 CDD:285625 87/313 (28%)
hut1NP_595251.1 UAA 7..304 CDD:285625 86/310 (28%)
EamA 188..304 CDD:304911 36/115 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 139 1.000 Domainoid score I1222
eggNOG 1 0.900 - - E1_COG0697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1367
OMA 1 1.010 - - QHG54403
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100819
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R581
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.