DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and HB51

DIOPT Version :10

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:71 Identity:25/71 - (35%)
Similarity:38/71 - (53%) Gaps:5/71 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 DGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNRRNKWKRQ 526
            :.|::..||.|  .:..|:..||.:|..:..|.|..:..|:..|.|...|:.:||||||.:||  
plant    70 NNNNEMIKKKR--LTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWK-- 130

  Fly   527 LAAELE 532
             |.:||
plant   131 -AKQLE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeodomain 469..525 CDD:459649 20/55 (36%)
HB51NP_195999.2 Homeodomain 77..130 CDD:459649 19/54 (35%)
HALZ 132..166 CDD:460477 2/4 (50%)

Return to query results.
Submit another query.