DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and hmx1

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001106998.1 Gene:hmx1 / 797503 ZFINID:ZDB-GENE-080204-54 Length:282 Species:Danio rerio


Alignment Length:177 Identity:97/177 - (54%)
Similarity:110/177 - (62%) Gaps:32/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 EEGEEIIEEDDGTDGPSDSSSPHGDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLA 502
            :||::..:..|...|| |:|.|    .|.|||||||||||:||||||||||:|||||||||||||
Zfish   125 DEGDDARQLFDERSGP-DTSEP----GSARKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLA 184

  Fly   503 ASLRLTETQVKIWFQNRRNKWKRQLAAELEAANMANMAHAAQRLVRVPVLYHDGTTAGFVPPPPP 567
            |||.|||||||||||||||||||||||:|||   .|..|.:||:||||:||||..|         
Zfish   185 ASLHLTETQVKIWFQNRRNKWKRQLAADLEA---VNFNHNSQRIVRVPILYHDKAT--------- 237

  Fly   568 HHHPMQYYAAARNTSPPRPPLSSLVXGVGCLATAPMSLLKPPNSMAH 614
               ||.  ..:.|.|...|||.... .|.          .|.:|.||
Zfish   238 ---PMS--TLSFNVSQVSPPLMGFSNSVN----------YPLSSFAH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 49/52 (94%)
hmx1NP_001106998.1 Homeobox 153..206 CDD:278475 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6091
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003349
OrthoInspector 1 1.000 - - otm25716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X983
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.