DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and hmx4

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001038836.2 Gene:hmx4 / 751654 ZFINID:ZDB-GENE-060825-142 Length:238 Species:Danio rerio


Alignment Length:179 Identity:78/179 - (43%)
Similarity:100/179 - (55%) Gaps:32/179 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 HHP----HPHLTGS----HGGYLLPSSSNESDEEGEEIIEEDDGTDGPSDSSSPHGDGNSKR--- 467
            |||    .|...||    ||       .::.:.||:..::.....|..|:|:....|...|.   
Zfish    48 HHPGESEDPCKEGSDARLHG-------IDKLNREGDATVDALKAVDMRSESADSCDDAQQKNNGK 105

  Fly   468 ------KKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNRRNKWKRQ 526
                  ||||||:||:.|:||||||||:||||||:|||.||.||:||||||||||||||||.|||
Zfish   106 KNKLMTKKKTRTIFSKRQIFQLESTFDMKRYLSSAERACLANSLQLTETQVKIWFQNRRNKLKRQ 170

  Fly   527 LAAELEAAN--MANMAHAAQRLVRVPVLYHDGTTAG--FVPPPPPHHHP 571
            |:.|||..|  ..::.    :.|.:|.||.:....|  .:|.|.|..:|
Zfish   171 LSTELEGPNSEFGDIG----KTVPLPALYKENNLLGRCMLPMPLPVVYP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 43/52 (83%)
hmx4NP_001038836.2 Homeobox 115..168 CDD:278475 43/52 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.