DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and hmx3a

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_571709.2 Gene:hmx3a / 60310 ZFINID:ZDB-GENE-001020-1 Length:297 Species:Danio rerio


Alignment Length:221 Identity:116/221 - (52%)
Similarity:133/221 - (60%) Gaps:46/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 QQQHPHQPTTPTSSSSSGGGSSLTHHPHPHLTGSHGGYLLPSSSNESDEE-----GEEII-EEDD 448
            |:.....|||.|...|            |.|       :|.|..:..|:|     |:||: ||.|
Zfish    98 QKARDSSPTTGTDRDS------------PEL-------VLKSDPDAKDDEDDNKSGDEIVLEESD 143

  Fly   449 GTDGPS----DSSSPHGDGNSK---RKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLR 506
            ..||..    |......||..|   |||||||||||:||||||||||:||||||||||||||||.
Zfish   144 TEDGKKEGGIDDWKKSDDGADKKPCRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLH 208

  Fly   507 LTETQVKIWFQNRRNKWKRQLAAELEAANMANMAHAAQRLVRVPVLYHDGT------TAGFVPPP 565
            |||||||||||||||||||||||||||||:::.  ||||:||||:|||:.:      |||.||..
Zfish   209 LTETQVKIWFQNRRNKWKRQLAAELEAANLSHA--AAQRIVRVPILYHENSASESTNTAGNVPVS 271

  Fly   566 PP---HHHPMQYYAAARNTSPP--RP 586
            .|   ..||: ||:....||.|  ||
Zfish   272 QPLLTFPHPV-YYSHPIVTSVPLLRP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 49/52 (94%)
hmx3aNP_571709.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..172 26/92 (28%)
Homeobox 173..226 CDD:278475 49/52 (94%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6091
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003349
OrthoInspector 1 1.000 - - otm25716
orthoMCL 1 0.900 - - OOG6_109246
Panther 1 1.100 - - O PTHR46110
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4603
SonicParanoid 1 1.000 - - X983
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.