DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and BARHL1

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_064448.1 Gene:BARHL1 / 56751 HGNCID:953 Length:327 Species:Homo sapiens


Alignment Length:336 Identity:95/336 - (28%)
Similarity:130/336 - (38%) Gaps:84/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 THDSSSTNTTENPP------SPTSMSPNNNNNNSNTTASSNQASKSPSHHPLHPLYHPLGSQQQQ 370
            :|.:.|....:..|      ||..:||.:.:::..::.:|.......:..|     .|.|:    
Human    14 SHRAGSPALPKGDPLLGDCRSPLELSPRSESSSDCSSPASPGRDCLETGTP-----RPGGA---- 69

  Fly   371 QQQQQHQQHPQQQQHPQQQQQQHPHQPTTPTSS-------------------SSSGGGSSLTHHP 416
                   ..|....|.|..|...|.|..|.|||                   ||||..::    |
Human    70 -------SGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQPAA----P 123

  Fly   417 HPHLTGSHGGYLL------------PSSSNESDEEGEEIIEEDDGTDGPSDSSSPHGDGNSKRKK 469
            .|      ||.|.            .|.||.|.:...::.||.|.....|..|.|   ...|:.:
Human   124 EP------GGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSPP---VRLKKPR 179

  Fly   470 KTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNRRNKWKRQLAAELEAA 534
            |.||.|:..|:.|||.:|:.::|||..:|..|||||.||:||||.|:||||.|||||.|..||..
Human   180 KARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVGLELL 244

  Fly   535 NMANMAHAAQRLVRVPVLYHDGTTAGFVP------------PPPPHHHPM------QYYAAARNT 581
            ..|....|.||:...|..|.....:...|            |||....|:      .....|...
Human   245 AEAGNYSALQRMFPSPYFYPQSLVSNLDPGAALYLYRGPSAPPPALQRPLVPRILIHGLQGASEP 309

  Fly   582 SPPRPPLSSLV 592
            .||.|||:.::
Human   310 PPPLPPLAGVL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 29/52 (56%)
BARHL1NP_064448.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 17/91 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..184 22/84 (26%)
Homeobox 182..235 CDD:395001 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.