DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and pou2f3

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_005172050.1 Gene:pou2f3 / 553427 ZFINID:ZDB-GENE-060512-299 Length:399 Species:Danio rerio


Alignment Length:365 Identity:80/365 - (21%)
Similarity:117/365 - (32%) Gaps:154/365 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 TENPPSPTSMSPNNNNNNSNTTASSNQAS---------KSPSHHPLHPLYHPLGSQQQ------- 369
            |||      ::.:.::.:|:.|....|.|         :.||.|||..|....||...       
Zfish    31 TEN------LNDSPHSGSSHKTCHLTQGSPLPPGQLTGEMPSLHPLPQLVLMPGSHLSSPSSFLL 89

  Fly   370 QQQQQQHQ----QHPQQQQHPQQQQQ-QHPHQP---TTPTSSSSSG-GGSSLTHH---PH---PH 419
            .|.|..||    ..|.....|.|.|. ..||||   .||.:...|| .|||:..|   .|   |.
Zfish    90 SQAQSGHQGLSLLPPNLLSLPSQTQTGLLPHQPGLALTPQAMGRSGLAGSSMDGHLDMSHLQVPK 154

  Fly   420 LTGSHGGYLLPSSSNESDEEGEE------------------------------------------ 442
            ..||      |.......||.|:                                          
Zfish   155 HVGS------PQDEPNDLEELEQFAKAFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEAL 213

  Fly   443 ------------IIEE--DDGTDGPSDSSS------PHGDG-NSKRKKKTRTVFSRAQVFQLEST 486
                        ::|:  .|..:.|||:.:      |..:| ..||||:|          .:|:.
Zfish   214 NLSFKNMCKLKPLLEKWLSDAENSPSDTMTNTTTLPPLMEGYGRKRKKRT----------SIETN 268

  Fly   487 FDL---KRYL-----SSSERAGLAASLRLTETQVKIWFQNRRNKWKRQLAAELEAANMANMAHAA 543
            ..|   ||:|     :|.|...::..|.:.:..|::||.|||.|.||                  
Zfish   269 IKLTLEKRFLDNPKPNSEEITLISEQLAMEKEVVRVWFCNRRQKEKR------------------ 315

  Fly   544 QRLVRVPVLYHDGTTAGFVPPPPPHHHPMQYYAAARNTSP 583
                    :|...:|:    |..||:...:..:.:|:.||
Zfish   316 --------IYCPVSTS----PIKPHNFNPRLPSTSRSFSP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 16/60 (27%)
pou2f3XP_005172050.1 POU 161..235 CDD:197673 5/73 (7%)
Homeobox 261..314 CDD:278475 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5492
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.