DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and Dlx6

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_008760963.2 Gene:Dlx6 / 500023 RGDID:1561539 Length:298 Species:Rattus norvegicus


Alignment Length:284 Identity:92/284 - (32%)
Similarity:130/284 - (45%) Gaps:71/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 GSQQQQQQQQQHQQHPQQQQHPQQQQQQ----------HPH-QPTTPT----------------- 401
            |.|||||||||.||  ||||  ||||||          .|| |.|:|.                 
  Rat    25 GQQQQQQQQQQQQQ--QQQQ--QQQQQQPPPPPPPPPPQPHSQQTSPAMAGAHYPLHCLHSAAAA 85

  Fly   402 -----------------SSSSSGGGSSLTHH---PHPHLTGS-HGGYL--LPSSSNESDEEGEEI 443
                             |..:||||:|..|.   .:|:::.| |..||  ..:||..:...|   
  Rat    86 AAAAGSHHHHHQHHHHGSPYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRG--- 147

  Fly   444 IEEDDGTDGPSDSSSPHGD----GNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAAS 504
                |.||....:...:|:    |..|:.:|.||::|..|:..|...|...:||:..|||.||||
  Rat   148 ----DDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAAS 208

  Fly   505 LRLTETQVKIWFQNRRNKWKRQL---AAELEAANMANMAHAAQRLVRVPVLYHDGTTAGFVPPPP 566
            |.||:|||||||||:|:|:|:.|   :...|:..:...|..:.|...:|.::....:|..|..||
  Rat   209 LGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLPGSAALSPRSPALPPVWDVSASAKGVSMPP 273

  Fly   567 PHHHP--MQYYAAARNTSPPRPPL 588
            ..:.|  ..:|::....:..||.:
  Rat   274 NSYMPGYSHWYSSPHQDTMQRPQM 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 29/52 (56%)
Dlx6XP_008760963.2 COG5576 124..280 CDD:227863 54/162 (33%)
Homeobox 175..229 CDD:395001 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.