DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and HMX3

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001099044.1 Gene:HMX3 / 340784 HGNCID:5019 Length:357 Species:Homo sapiens


Alignment Length:426 Identity:144/426 - (33%)
Similarity:182/426 - (42%) Gaps:157/426 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 ASAAAAAAAAAVAAANLSNNSNDSNGSSGGGGG--KSTTGSNGFTSFSISSILSRSEPAKKNGAA 252
            |||||||||||.|||         .|:..|..|  .|..|...|..|.|        ||::..  
Human    59 ASAAAAAAAAAAAAA---------KGALEGAAGFALSQVGDLAFPRFEI--------PAQRFA-- 104

  Fly   253 GLITPIPQLPQPGAGGPQDAAMLSRLGFISQWGALAGRYAALCPPGWPWAPQRLP---FHSPTHD 314
                    ||         |..|.|                  .|.| |.|..|.   .|.|..:
Human   105 --------LP---------AHYLER------------------SPAW-WYPYTLTPAGGHLPRPE 133

  Fly   315 SS----------STNTTENPPSP-TSMSPNNNNNNSNTTASSNQASKSPSHHPLHPLYHPLGSQQ 368
            :|          ::.|..:.|.| ....|::...:          ||||....|           
Human   134 ASEKALLRDSSPASGTDRDSPEPLLKADPDHKELD----------SKSPDEIIL----------- 177

  Fly   369 QQQQQQQHQQHPQQQQHPQQQQQQHPHQPTTPTSSSSSGGGSSLTHHPHPHLTGSHGGYLLPSSS 433
            ::...::.::..:                ..|.::.:|.|.::.|                |.: 
Human   178 EESDSEESKKEGE----------------AAPGAAGASVGAAAAT----------------PGA- 209

  Fly   434 NESDEEGEEIIEEDDGTDGPSDSSSPHGDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSER 498
             |..::|.|           |....|     :.|||||||||||:||||||||||:|||||||||
Human   210 -EDWKKGAE-----------SPEKKP-----ACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSER 257

  Fly   499 AGLAASLRLTETQVKIWFQNRRNKWKRQLAAELEAANMANMAHAAQRLVRVPVLYH-----DGTT 558
            |||||||.|||||||||||||||||||||||||||||:::.  ||||:||||:|||     :|..
Human   258 AGLAASLHLTETQVKIWFQNRRNKWKRQLAAELEAANLSHA--AAQRIVRVPILYHENSAAEGAA 320

  Fly   559 AGFVPPPPPHHHPM------QYYAAARNTSPP--RP 586
            |.....|.|...|:      .||:....:|.|  ||
Human   321 AAAAGAPVPVSQPLLTFPHPVYYSHPVVSSVPLLRP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 49/52 (94%)
HMX3NP_001099044.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..229 23/170 (14%)
Homeobox 230..283 CDD:278475 49/52 (94%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6248
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003349
OrthoInspector 1 1.000 - - otm40284
orthoMCL 1 0.900 - - OOG6_109246
Panther 1 1.100 - - O PTHR46110
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4603
SonicParanoid 1 1.000 - - X983
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.