DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and dlx5a

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_571381.2 Gene:dlx5a / 30569 ZFINID:ZDB-GENE-990415-49 Length:282 Species:Danio rerio


Alignment Length:292 Identity:79/292 - (27%)
Similarity:115/292 - (39%) Gaps:97/292 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 PQQQQHP-QQQQQQHPHQ--PTTPTSSSSSGG--------------------GSSLTHHPHPH-- 419
            |...|:| |.....||.|  ||.|.|:::..|                    |..|..:.:.:  
Zfish    14 PADFQNPFQLSTMHHPSQESPTLPESTATDSGYYSPAGGVHHGYCSPNSGTYGKPLNAYQYQYHG 78

  Fly   420 LTGSHGGYLLPS---------------------SSNESDEEGEEIIEEDDGTDGPSDSSSPH--- 460
            :.||.|.|...|                     .|..|.:|.|              ::.|.   
Zfish    79 VNGSSGNYSAKSYPDYGSYSTAYHQYAGTYNRVQSQPSPQEKE--------------TAEPEVRM 129

  Fly   461 GDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNRRNKWKR 525
            .:|..|:.:|.||::|..|:..|:..|...:||:..|||.|||||.||:|||||||||:|:|.|:
Zfish   130 VNGKPKKVRKPRTIYSSFQLAALQRRFQNTQYLALPERAELAASLGLTQTQVKIWFQNKRSKLKK 194

  Fly   526 -----QLAAELEAANMANMA-HAAQRLVRVPVLYHDGTTAGFVPPPPPHHHPM------------ 572
                 :|..|...::...|| ::.|.    |.::   .:.|   |..|||.|.            
Zfish   195 IMKNGELPPEHSPSSSDPMACNSPQS----PAVW---DSQG---PQRPHHQPQNINTAASTFLES 249

  Fly   573 ---QYYAA--ARNTSPPRP-PLSSLVXGVGCL 598
               .:|::  |.|:....| .|.||..|.|.|
Zfish   250 ASSSWYSSTGAMNSHLQAPGTLHSLALGSGTL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 29/52 (56%)
dlx5aNP_571381.2 DLL_N 31..118 CDD:289198 15/86 (17%)
Homeobox 140..193 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.