DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and Dlx4

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001100510.1 Gene:Dlx4 / 303469 RGDID:1308744 Length:238 Species:Rattus norvegicus


Alignment Length:192 Identity:56/192 - (29%)
Similarity:82/192 - (42%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PTTP-----TSSSSSGGGSSLTHHPHPHLTGSHGGYLLPSSSNESDEEGEEIIEEDDGTDGPSDS 456
            |.||     :|...|...|...|.|..|             ..|.:.|.|::          :.|
  Rat    62 PATPGDSYLSSQQQSAAPSRPFHQPTEH-------------PQELEAESEKL----------ALS 103

  Fly   457 SSPHGDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNRRN 521
            ..|.....:::.:|.||::|..|:..|...|...:||:..|||.|||.|.||:|||||||||:|:
  Rat   104 LEPSQPSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRS 168

  Fly   522 KWK---RQLAAELEAANMANMAHAAQRLVRVPVLYHDGTTAGFVPPPP---------PHHHP 571
            |:|   :|.:.|||..........:...:.:|.:: |...||.:|...         .||.|
  Rat   169 KYKKLLKQSSGELEEDFSGRPPSLSPHSLTLPSIW-DLPKAGTLPTSGYDNSFGTWYQHHSP 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 28/52 (54%)
Dlx4NP_001100510.1 Homeobox 118..172 CDD:395001 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.