DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and Dlx2

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001178675.1 Gene:Dlx2 / 296499 RGDID:1304853 Length:332 Species:Rattus norvegicus


Alignment Length:370 Identity:95/370 - (25%)
Similarity:133/370 - (35%) Gaps:104/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 HSPTHDSSST-NTTENPPSPTSMSPNNNNNNSNTTASSNQASKSPSHHPLHPLYHPLGSQQQQQQ 372
            ||....:||| :..:.|||........::|:|    |||.....|...|..|:     |......
  Rat    13 HSTQITASSTYHQHQQPPSGAGAGSGGSSNSS----SSNSNLHKPQESPTLPV-----STATDSS 68

  Fly   373 QQQHQQHPQQQQHPQQQQQQHPHQPTTPTSSSSSGGGSSLTHHPHPHLTGSHGGYLLPSSS-NES 436
            ...:||||                      :...|||:|    |:.|:    |.|...:|. |..
  Rat    69 YYTNQQHP----------------------AGGGGGGAS----PYAHM----GSYQYHASGLNNV 103

  Fly   437 DEEGEEIIEEDDGTDGPSDSSSPHG----------------------DGNSKRKKKTRTVFSRAQ 479
            ....:.  ..|.|......|.:|:|                      :|..|:.:|.||::|..|
  Rat   104 SYSAKS--SYDLGYTAAYTSYAPYGTSSSPVNNEPDKEDLEPEIRIVNGKPKKVRKPRTIYSSFQ 166

  Fly   480 VFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNRRNKWKRQLAAELEAANMANMAHAAQ 544
            :..|:..|...:||:..|||.|||||.||:|||||||||||:|:|:...:.              
  Rat   167 LAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSG-------------- 217

  Fly   545 RLVRVPVLYHDGTTAGFVPP--PPPHHHPMQYYAAARNTSPPRPPLSSLVXGVGCLATAPMSLL- 606
               .:|...|.|.:|.  ||  .||...|..:...|:.......| .|.. |.|...::|.|.. 
  Rat   218 ---EIPTEQHPGASAS--PPCASPPVSAPASWDFGAQQRMAGGGP-GSGGSGAGSSGSSPSSAAS 276

  Fly   607 ----------KPPNSMAH----PP--HPQPPPPAPLHMQQRSFLG 635
                      :...|.:|    .|  ||...|.|..|.......|
  Rat   277 AFLGNYPWYHQASGSASHLQATAPLLHPSQTPQAHHHHHHHHHAG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 30/52 (58%)
Dlx2NP_001178675.1 DLL_N 54..135 CDD:289198 22/117 (19%)
Homeobox 158..211 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.