DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and Dlx3

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001099302.1 Gene:Dlx3 / 287638 RGDID:1304875 Length:287 Species:Rattus norvegicus


Alignment Length:277 Identity:83/277 - (29%)
Similarity:109/277 - (39%) Gaps:79/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 PTTPTSSSSSGG---------------GSSL---THHPHPHLTGSHG-GYLLPSS----SNESDE 438
            ||.|.||.:..|               |.::   |:|...:|.|..| |...|.|    .....:
  Rat    30 PTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGGSYRQ 94

  Fly   439 EGEEIIEEDDGTDGPSDSSSPHGD-----GNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSER 498
            .|....:.....|..|....|..:     |..|:.:|.||::|..|:..|:..|...:||:..||
  Rat    95 YGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPER 159

  Fly   499 AGLAASLRLTETQVKIWFQNRRNKWKR-----QLAAELEAANMANMAHAAQRLVRVPVLYHDGTT 558
            |.|||.|.||:|||||||||||:|:|:     ::..|....|..:||..:               
  Rat   160 AELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNS--------------- 209

  Fly   559 AGFVPPPP------PHHHPMQYYAAARNTSPPRPPLSSLVXGVGCLATAPMSLLKPPNSMAHP-- 615
                ||.|      .|..|    |..||..||..|.|:          :|..|..|.||..|.  
  Rat   210 ----PPSPALWDTSSHSTP----APTRNPLPPPLPYSA----------SPNYLDDPTNSWYHTQN 256

  Fly   616 ---PH--PQPPPPAPLH 627
               ||  .|||.||.||
  Rat   257 LSGPHLQQQPPQPATLH 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 29/52 (56%)
Dlx3NP_001099302.1 DLL_N 27..107 CDD:403572 16/76 (21%)
COG5576 <109..230 CDD:227863 46/143 (32%)
Homeobox 132..186 CDD:395001 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.