DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and ceh-9

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001021797.1 Gene:ceh-9 / 267057 WormBaseID:WBGene00000434 Length:147 Species:Caenorhabditis elegans


Alignment Length:97 Identity:46/97 - (47%)
Similarity:59/97 - (60%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 LPSSSNESDEEGEEIIEEDDGTDGPSDSSSPHGDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYL 493
            ||:.:.|.||.|......|...:.|.:..      ...::||.||.||..|||:||..|:.|:||
 Worm    37 LPTVNGEIDEFGRCKSSLDQAKESPIEKC------QKTKRKKARTTFSGKQVFELEKQFEAKKYL 95

  Fly   494 SSSERAGLAASLRLTETQVKIWFQNRRNKWKR 525
            |||:|:.||..|.:|||||||||||||.|||:
 Worm    96 SSSDRSELAKRLDVTETQVKIWFQNRRTKWKK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 34/52 (65%)
ceh-9NP_001021797.1 Homeobox 74..126 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.