DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and Dlx5

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_037075.1 Gene:Dlx5 / 25431 RGDID:2506 Length:289 Species:Rattus norvegicus


Alignment Length:323 Identity:81/323 - (25%)
Similarity:126/323 - (39%) Gaps:94/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 PSPTSMSPNNNNNNSNTTASSNQASKSPSHHPLHPLYHPLGSQQQQQQQQQHQQHPQQQQHPQQQ 389
            |.|||.:.::.:..|.|...|:.....        .|.|.|:.                      
  Rat    20 PFPTSAAMHHPSQESPTLPESSATDSD--------YYSPAGAA---------------------- 54

  Fly   390 QQQHPHQPTTPTSSSSSGGGSSLTHHPHPHLTGSHGGY----------------------LLPSS 432
                ||...:|||:|.....:...:..| .:.||..||                      .:||:
  Rat    55 ----PHGYCSPTSASYRKALNPYQYQYH-SVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSA 114

  Fly   433 SNESDEEGEEIIEEDDGTDGPSDSSSPH---GDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLS 494
            :::.::|..|                |.   .:|..|:.:|.||::|..|:..|:..|...:||:
  Rat   115 TSQPEKEVAE----------------PEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLA 163

  Fly   495 SSERAGLAASLRLTETQVKIWFQNRRNKWKR-----QLAAELEAANMANMA-HAAQRLVRVPVLY 553
            ..|||.|||||.||:|||||||||:|:|.|:     ::..|...::...|| ::.|.    |.::
  Rat   164 LPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQS----PAVW 224

  Fly   554 H-DGTTAGFVPPPPPHHHPMQYYAAARNTSPPRPPLSSLVXGVGCLATAPMSLLKPPNSMAHP 615
            . .|::...  ...||.||     ...|.||....|.:........|::..|.|.||.|:.||
  Rat   225 EPQGSSRSL--SHHPHAHP-----TTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHP 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 29/52 (56%)
Dlx5NP_037075.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 7/36 (19%)
DLL_N 32..118 CDD:289198 19/120 (16%)
Homeobox 140..193 CDD:278475 29/52 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..253 13/65 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289 6/11 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.