DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and ceh-27

DIOPT Version :10

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_001256348.1 Gene:ceh-27 / 185853 WormBaseID:WBGene00000449 Length:263 Species:Caenorhabditis elegans


Alignment Length:59 Identity:32/59 - (54%)
Similarity:42/59 - (71%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 KKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNRRNKWKRQ 526
            ::|.|.:||..||..||..|.:.||||:::|..||.|:.|:.|||||||||:|.|.|||
 Worm    98 RRKRRVLFSPQQVHVLERKFQINRYLSAADRENLAKSINLSATQVKIWFQNQRYKCKRQ 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeodomain 469..525 CDD:459649 29/55 (53%)
ceh-27NP_001256348.1 Homeodomain 99..155 CDD:459649 29/55 (53%)

Return to query results.
Submit another query.