DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and vab-7

DIOPT Version :10

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_499401.1 Gene:vab-7 / 176521 WormBaseID:WBGene00006873 Length:247 Species:Caenorhabditis elegans


Alignment Length:146 Identity:27/146 - (18%)
Similarity:51/146 - (34%) Gaps:61/146 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AVINLFIMTLPLVS--YSWSLLNIKMTNEIGFGNIWQVVIPHLAWIAGYISIYQFLHVLLFVFTF 213
            |::|| :::|.:.|  |..|.||:.::|          .:|. .|:...:|..:.|:        
 Worm   113 ALVNL-VISLAVTSGKYLDSCLNMLVSN----------FVPP-PWVVNNLSHSRILN-------- 157

  Fly   214 TVSLFTFYLLTAQVFCIYQGQTRIEFLMDVHAYQLGLLENLHQSLGSRWPFIAISCFIPSPLPTD 278
                                 .:|:.|..|||                 ..:.||..:|. .|:.
 Worm   158 ---------------------KKIDVLSRVHA-----------------ALLKISILVPL-TPSR 183

  Fly   279 GLGFVTREMFNLHTKD 294
            .:..:.::|..:|.||
 Worm   184 LVPMLFQQMPKMHKKD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeodomain 469..525 CDD:459649
vab-7NP_499401.1 Homeodomain 69..125 CDD:459649 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.