DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and Hmx2

DIOPT Version :10

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_666110.1 Gene:Hmx2 / 15372 MGIID:107159 Length:273 Species:Mus musculus


Alignment Length:96 Identity:23/96 - (23%)
Similarity:34/96 - (35%) Gaps:28/96 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DGENVDFNKKLQRMMP--------TQIQDIIATFIFLILLPCG--ILLHLLYVLPTWYPVMGEAW 61
            ||.|.    |..|:||        .:|.|.|......:.:|..  |::.|..:||          
Mouse   228 DGANT----KWPRLMPILDPDYACRKIVDAIRREQVYLYMPRSIYIIIGLRNLLP---------- 278

  Fly    62 VIRATCFGVLVFNLYSNWVYMIKTGPNGHHS 92
                |..|||:......:.:|.|...:|..|
Mouse   279 ----TKVGVLLGEYLGAFNFMAKFKGHGQKS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeodomain 469..525 CDD:459649
Hmx2NP_666110.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..154
Homeodomain 150..206 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.