DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and Dlx4

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:NP_031893.3 Gene:Dlx4 / 13394 MGIID:94904 Length:240 Species:Mus musculus


Alignment Length:231 Identity:67/231 - (29%)
Similarity:91/231 - (39%) Gaps:68/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 LPFHSPTHDSSSTNTTENPPS-------PTSMSPNNNNNNSNTTASSNQASKSPSH-HPLHPLYH 362
            ||...|...:|:....:..|:       |..:||.        ||:|...|.|.|: || ....|
Mouse     4 LPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPG--------TAASPDLSYSQSYGHP-RSYSH 59

  Fly   363 PLGSQQQQQQQQQHQQHPQQQQHPQQQQQQHPHQPTTPTSSSSSGGGSSLTHHPHPHLTGSHGGY 427
            |            ....|.....|:|||...|.||               .|.|..|        
Mouse    60 P------------GPATPGDSYLPRQQQLVAPSQP---------------FHRPAEH-------- 89

  Fly   428 LLPSSSNESDEEGEEIIEEDDGTDGPSDSSSPHGDGNSKRK-KKTRTVFSRAQVFQLESTFDLKR 491
                 ..|.:.|.|::          :.|..|....:..|| :|.||::|..|:..|...|...:
Mouse    90 -----PQELEAESEKL----------ALSLVPSQQQSLTRKLRKPRTIYSSLQLQHLNQRFQHTQ 139

  Fly   492 YLSSSERAGLAASLRLTETQVKIWFQNRRNKWKRQL 527
            ||:..|||.|||.|.||:|||||||||:|:|:|:.|
Mouse   140 YLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 28/52 (54%)
Dlx4NP_031893.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70 8/38 (21%)
Homeobox 119..172 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..194 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574097at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.