Sequence 1: | NP_001262674.1 | Gene: | Hmx / 42110 | FlyBaseID: | FBgn0264005 | Length: | 718 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034183.1 | Gene: | Dlx1 / 13390 | MGIID: | 94901 | Length: | 255 | Species: | Mus musculus |
Alignment Length: | 230 | Identity: | 74/230 - (32%) |
---|---|---|---|
Similarity: | 104/230 - (45%) | Gaps: | 41/230 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 380 PQQQQHPQQQQQQH----------PHQPTTPTSSSSSGGGSSLTHHPHPHLTGSHGG--YLLPSS 432
Fly 433 SNESDEEGEEIIE---EDDGTDGPSDSSSPHGD----GNSKRKKKTRTVFSRAQVFQLESTFDLK 490
Fly 491 RYLSSSERAGLAASLRLTETQVKIWFQNRRNKWK---RQLAAELEAANMANMAHAAQRLVRVPVL 552
Fly 553 YH--------DGTTAG-FVPP-----PPPHHHPMQ 573 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hmx | NP_001262674.1 | Homeobox | 471..524 | CDD:278475 | 29/52 (56%) |
Dlx1 | NP_034183.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..38 | 4/11 (36%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 95..118 | 4/22 (18%) | |||
Homeobox | 131..185 | CDD:395001 | 29/53 (55%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..233 | 5/28 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D574097at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |