DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and hmx3b

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_017214099.1 Gene:hmx3b / 108191768 ZFINID:ZDB-GENE-130603-102 Length:196 Species:Danio rerio


Alignment Length:137 Identity:87/137 - (63%)
Similarity:99/137 - (72%) Gaps:13/137 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 PSSSNESDEEGEEIIEEDDGTDGPSDSSSPHGDGNSK-RKKKTRTVFSRAQVFQLESTFDLKRYL 493
            |..|.|.|::.||...||      ||........... |||||||||||||||||||||||||||
Zfish    67 PGPSAEDDDDDEEAPLED------SDCEEARAQVKKLCRKKKTRTVFSRAQVFQLESTFDLKRYL 125

  Fly   494 SSSERAGLAASLRLTETQVKIWFQNRRNKWKRQLAAELEAANMANMAHAAQRLVRVPVLYHDGTT 558
            ||||||||||||.||||||||||||||||||||:|||||:|::::    |.|:|||||:||:  .
Zfish   126 SSSERAGLAASLHLTETQVKIWFQNRRNKWKRQIAAELESASLSH----AHRVVRVPVIYHE--H 184

  Fly   559 AGFVPPP 565
            |.:.|.|
Zfish   185 ALYYPHP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 51/52 (98%)
hmx3bXP_017214099.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6091
eggNOG 1 0.900 - - E1_KOG0485
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003349
OrthoInspector 1 1.000 - - otm25716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.