DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmx and hmx1

DIOPT Version :9

Sequence 1:NP_001262674.1 Gene:Hmx / 42110 FlyBaseID:FBgn0264005 Length:718 Species:Drosophila melanogaster
Sequence 2:XP_002940264.3 Gene:hmx1 / 100498485 XenbaseID:XB-GENE-6259139 Length:281 Species:Xenopus tropicalis


Alignment Length:269 Identity:111/269 - (41%)
Similarity:136/269 - (50%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 QPTTPTSSSSS----------------GGGSSLTHHPHP-HLTGSH------------------- 424
            |.||.|:..||                ..|:...||..| .|||.|                   
 Frog     9 QSTTTTARVSSFFIENLLGTESKEEKKRKGADSGHHAQPSELTGGHFSSLCCQISPYHYSYPLRE 73

  Fly   425 ----------GGYLLPSSSNESDEEGEEIIEEDDG--------TDGP---------------SDS 456
                      ..|:..:|.:.||.:..||.|..:|        ::.|               .:.
 Frog    74 NTMEWYRRAQATYIGCTSPDTSDRDSPEIAEAGEGPGRGLRKHSESPGERREDYACKEEEEEEEK 138

  Fly   457 SSPHGDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNRRN 521
            :....|..|.|||||||||||:||||||||||:||||||||||||||||.|||||||||||||||
 Frog   139 AEQDSDQRSSRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRN 203

  Fly   522 KWKRQLAAELEAANMANMAHAAQRLVRVPVLYHDGTTAGFVPPPPPHHHPMQYYAAARNTSPPRP 586
            ||||||||:|||   ||::|.:||:||||:|||:.:.|..:....||..|    |....:||...
 Frog   204 KWKRQLAADLEA---ANISHTSQRIVRVPILYHENSAATSMGFNLPHVSP----ALVGFSSPVNY 261

  Fly   587 PLSSLVXGV 595
            ||:|:...|
 Frog   262 PLASIPNSV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HmxNP_001262674.1 Homeobox 471..524 CDD:278475 49/52 (94%)
hmx1XP_002940264.3 Homeobox 153..207 CDD:395001 50/53 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6173
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003349
OrthoInspector 1 1.000 - - otm47460
Panther 1 1.100 - - LDO PTHR46110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X983
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.