Sequence 1: | NP_001262674.1 | Gene: | Hmx / 42110 | FlyBaseID: | FBgn0264005 | Length: | 718 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002940264.3 | Gene: | hmx1 / 100498485 | XenbaseID: | XB-GENE-6259139 | Length: | 281 | Species: | Xenopus tropicalis |
Alignment Length: | 269 | Identity: | 111/269 - (41%) |
---|---|---|---|
Similarity: | 136/269 - (50%) | Gaps: | 76/269 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 396 QPTTPTSSSSS----------------GGGSSLTHHPHP-HLTGSH------------------- 424
Fly 425 ----------GGYLLPSSSNESDEEGEEIIEEDDG--------TDGP---------------SDS 456
Fly 457 SSPHGDGNSKRKKKTRTVFSRAQVFQLESTFDLKRYLSSSERAGLAASLRLTETQVKIWFQNRRN 521
Fly 522 KWKRQLAAELEAANMANMAHAAQRLVRVPVLYHDGTTAGFVPPPPPHHHPMQYYAAARNTSPPRP 586
Fly 587 PLSSLVXGV 595 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hmx | NP_001262674.1 | Homeobox | 471..524 | CDD:278475 | 49/52 (94%) |
hmx1 | XP_002940264.3 | Homeobox | 153..207 | CDD:395001 | 50/53 (94%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 111 | 1.000 | Domainoid score | I6173 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0003349 | |
OrthoInspector | 1 | 1.000 | - | - | otm47460 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR46110 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X983 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 7.010 |