DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEIS1 and achi

DIOPT Version :9

Sequence 1:NP_002389.1 Gene:MEIS1 / 4211 HGNCID:7000 Length:390 Species:Homo sapiens
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:245 Identity:63/245 - (25%)
Similarity:97/245 - (39%) Gaps:62/245 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   158 ELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSK--SDSEDITRSANLTDQPSWNRDHDDT 220
            |.|:|:.:.|....:.|..:..:..:...:.:.||..:  |||.        .||.|.:.|    
  Fly     5 EQEEVNMVLDRHVRQNIQDMMHEAHVQASLLENEGRGRFHSDSS--------LDQDSLHAD---- 57

Human   221 ASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATN 285
                            .....|.|:|.|.....:........:...|.:....|:||..||.:..
  Fly    58 ----------------VIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKRRGNLPKTSVK 106

Human   286 IMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS------------ 338
            |::.||::|..:.|||:.:|..|:|:..||:|||.||||||||||:..||.:.            
  Fly   107 ILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISRR 171

Human   339 --------NRAVSQG---TPYNP-DGQPMGGFVMD--------GQQHMGI 368
                    :|:.:.|   |..|| .|.|....|:.        |:.|.||
  Fly   172 GKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGI 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEIS1NP_002389.1 Meis_PKNOX_N 108..192 CDD:406806 5/33 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..279 17/90 (19%)
Homeobox_KN 290..329 CDD:399131 21/38 (55%)
Interaction with DNA. /evidence=ECO:0000305|PubMed:26550823, ECO:0000305|PubMed:28473536 299..329 18/29 (62%)
Required for transcriptional activation. /evidence=ECO:0000250 335..390 13/66 (20%)
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 21/38 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.