Sequence 1: | NP_002389.1 | Gene: | MEIS1 / 4211 | HGNCID: | 7000 | Length: | 390 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286352.1 | Gene: | achi / 36373 | FlyBaseID: | FBgn0033749 | Length: | 555 | Species: | Drosophila melanogaster |
Alignment Length: | 245 | Identity: | 63/245 - (25%) |
---|---|---|---|
Similarity: | 97/245 - (39%) | Gaps: | 62/245 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 158 ELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSK--SDSEDITRSANLTDQPSWNRDHDDT 220
Human 221 ASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATN 285
Human 286 IMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQS------------ 338
Human 339 --------NRAVSQG---TPYNP-DGQPMGGFVMD--------GQQHMGI 368 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MEIS1 | NP_002389.1 | Meis_PKNOX_N | 108..192 | CDD:406806 | 5/33 (15%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 190..279 | 17/90 (19%) | |||
Homeobox_KN | 290..329 | CDD:399131 | 21/38 (55%) | ||
Interaction with DNA. /evidence=ECO:0000305|PubMed:26550823, ECO:0000305|PubMed:28473536 | 299..329 | 18/29 (62%) | |||
Required for transcriptional activation. /evidence=ECO:0000250 | 335..390 | 13/66 (20%) | |||
achi | NP_001286352.1 | Homeobox_KN | 111..150 | CDD:283551 | 21/38 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152655 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |