DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and Prdx6

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_446028.1 Gene:Prdx6 / 94167 RGDID:71005 Length:224 Species:Rattus norvegicus


Alignment Length:203 Identity:53/203 - (26%)
Similarity:99/203 - (48%) Gaps:25/203 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 APDFKGLAVVDNSFQEVKLEDYRG-KYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGV 109
            ||:|:    .:.:...::..|:.| .:.:||.:|.|||.||.||:...::...||...|.:::.:
  Rat    11 APNFE----ANTTIGHIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIAL 71

  Fly   110 SVDSHFSHLTWC-NVDRKNGG--VGQLKYPLLSDLTKKISADYDVLL--------DKEG--ISLR 161
            |:||...|..|. :::..||.  ..:|.:|::.|..:    |..:||        |::|  ::.|
  Rat    72 SIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDR----DLAILLGMLDPAEKDEKGMPVTAR 132

  Fly   162 GTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIK--PDVE 224
            ..||..|:..|:...:.....||:.||:||::.:.|....:....|.:|....:...:.  |: |
  Rat   133 VVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVDWKKGESVMVLPTLPE-E 196

  Fly   225 ESKKYFSK 232
            |:|:.|.|
  Rat   197 EAKQLFPK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 53/203 (26%)
PRX_Typ2cys 42..212 CDD:239313 47/179 (26%)
1-cysPrx_C 195..232 CDD:287400 8/38 (21%)
Prdx6NP_446028.1 AhpC 5..200 CDD:223527 50/197 (25%)
PRX_1cys 7..222 CDD:239314 53/203 (26%)
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000269|PubMed:19700648 31..40 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.