DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and Prdx4

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_017457660.1 Gene:Prdx4 / 85274 RGDID:620043 Length:282 Species:Rattus norvegicus


Alignment Length:186 Identity:107/186 - (57%)
Similarity:140/186 - (75%) Gaps:5/186 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IAARLLHQTAPLAAVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIV 90
            :|...||    |:..::.:|||.::|.||::..|:|:||.||||||||.|||||||||||||||:
  Rat    79 VADHSLH----LSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEII 139

  Fly    91 AFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDK 155
            ||.:||:||..|||||:..||||.|:||.|.|..|:.||:|.::.||||||..:||.||.|.|:.
  Rat   140 AFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLED 204

  Fly   156 EGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCP-ANW 210
            .|.:|||.||||..|:|||.::|||||||||||.|||::|||:.::|||..| ::|
  Rat   205 SGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEDNPRSSW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 103/172 (60%)
PRX_Typ2cys 42..212 CDD:239313 103/170 (61%)
1-cysPrx_C 195..232 CDD:287400 8/17 (47%)
Prdx4XP_017457660.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.