DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and TSA2

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_010741.1 Gene:TSA2 / 852064 SGDID:S000002861 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:189 Identity:108/189 - (57%)
Similarity:141/189 - (74%) Gaps:2/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEV 106
            ||:.||.||..||||..|:|:.||.|:|||:||.|.||.|:|||||||||||:..|:|.|...:|
Yeast     5 VQKQAPPFKKTAVVDGIFEEISLEKYKGKYVVLAFVPLAFSFVCPTEIVAFSDAAKKFEDQGAQV 69

  Fly   107 LGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGI 171
            |..|.||.:|.|.|.|:.||:||:|.:|.|||:|....:|.||.||::||||:|||.|||||.||
Yeast    70 LFASTDSEYSLLAWTNLPRKDGGLGPVKVPLLADKNHSLSRDYGVLIEKEGIALRGLFIIDPKGI 134

  Fly   172 LRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYF 230
            :|..:||||.|||:|:|.|||::.||:.:::|.|.|.||.|.:  |||||||::||:||
Yeast   135 IRHITINDLSVGRNVNEALRLVEGFQWTDKNGTVLPCNWTPGA--ATIKPDVKDSKEYF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 108/189 (57%)
PRX_Typ2cys 42..212 CDD:239313 96/169 (57%)
1-cysPrx_C 195..232 CDD:287400 19/36 (53%)
TSA2NP_010741.1 PRX_Typ2cys 5..176 CDD:239313 96/170 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346742
Domainoid 1 1.000 161 1.000 Domainoid score I848
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4944
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
TreeFam 00.000 Not matched by this tool.
109.650

Return to query results.
Submit another query.