DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and PER1

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_175247.1 Gene:PER1 / 841231 AraportID:AT1G48130 Length:216 Species:Arabidopsis thaliana


Alignment Length:182 Identity:58/182 - (31%)
Similarity:93/182 - (51%) Gaps:8/182 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VDNSFQEVKLEDY-RGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGVSVDSHFSHL 118
            |:.:..:.||.|| ...:.|||.:|.|||.||.||:.|.::...||.....::||:|.|...||.
plant    15 VETTHDKFKLHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRGVKLLGLSCDDVQSHK 79

  Fly   119 TWC-NVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGILRQYSINDLPV 182
            .|. :::..|.| .::.||:::|..|:|....:::...|....|...|:.|:..::...:.....
plant    80 DWIKDIEAFNHG-SKVNYPIIADPNKEIIPQLNMIDPIENGPSRALHIVGPDSKIKLSFLYPSTT 143

  Fly   183 GRSVDEVLRLIKAFQFVEQHGE--VCPANWNPNSNPATIKPDV--EESKKYF 230
            ||::|||||.:.:.....:|..  ..|.||.|: .|..|.|.|  ||:||.|
plant   144 GRNMDEVLRALDSLLMASKHNNKIATPVNWKPD-QPVVISPAVSDEEAKKMF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 58/182 (32%)
PRX_Typ2cys 42..212 CDD:239313 48/160 (30%)
1-cysPrx_C 195..232 CDD:287400 14/40 (35%)
PER1NP_175247.1 PRX_1cys 6..214 CDD:239314 58/182 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.