DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and PRXQ

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001189979.1 Gene:PRXQ / 822203 AraportID:AT3G26060 Length:217 Species:Arabidopsis thaliana


Alignment Length:211 Identity:59/211 - (27%)
Similarity:98/211 - (46%) Gaps:34/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IRNVPLMGKAILSQQKQIAAR----------LLHQT--APLAA-----------VRVQQPAPDFK 50
            :|.:||....:...|..:..:          |.|.:  :|:::           |...|.|||| 
plant    16 LRTLPLRKTLVTKTQFSVPTKSSESNFFGSTLTHSSYISPVSSSSLKGLIFAKQVNKGQAAPDF- 79

  Fly    51 GLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGVSVDSHF 115
              .:.|.:.:.|.|:.|:||.:||:|||.|.|..|..:..||.:..::|.....||:|:|.|...
plant    80 --TLKDQNGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSA 142

  Fly   116 SHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEG-ISLRGTFIIDPNGILRQYSIND 179
            ||..:.:..:       |.|.||||...|:..|:.|..|..| :..|.|:::|.||:::....|.
plant   143 SHKAFASKYK-------LPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQ 200

  Fly   180 LPVGRSVDEVLRLIKA 195
            ....:.:||.|:.:||
plant   201 FQPEKHIDETLKFLKA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 52/157 (33%)
PRX_Typ2cys 42..212 CDD:239313 51/155 (33%)
1-cysPrx_C 195..232 CDD:287400 1/1 (100%)
PRXQNP_001189979.1 PRX_BCP 74..212 CDD:239315 48/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR42801
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.980

Return to query results.
Submit another query.