DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and PRDX2

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_005800.3 Gene:PRDX2 / 7001 HGNCID:9353 Length:198 Species:Homo sapiens


Alignment Length:193 Identity:125/193 - (64%)
Similarity:156/193 - (80%) Gaps:2/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTE 105
            |:.:||||||..||||.:|:||||.||:|||:|||||||||||||||||:|||.|.::|..:..|
Human     7 RIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCE 71

  Fly   106 VLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNG 170
            ||||||||.|:||.|.|..||.||:|.|..|||:|:|:::|.||.||...|||:.||.||||..|
Human    72 VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKG 136

  Fly   171 ILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSKH 233
            :|||.::|||||||||||.|||::|||:.::|||||||.|.|.|:  ||||:|::||:|||||
Human   137 VLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSD--TIKPNVDDSKEYFSKH 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 123/191 (64%)
PRX_Typ2cys 42..212 CDD:239313 110/169 (65%)
1-cysPrx_C 195..232 CDD:287400 22/36 (61%)
PRDX2NP_005800.3 PRX_Typ2cys 8..179 CDD:239313 110/170 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10797
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.