DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and prdx3

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001025608.1 Gene:prdx3 / 594996 XenbaseID:XB-GENE-994377 Length:243 Species:Xenopus tropicalis


Alignment Length:236 Identity:144/236 - (61%)
Similarity:172/236 - (72%) Gaps:9/236 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SFVARS-LIRNVPLMGKAILSQQKQIAARLLHQTAPLAAVR----VQQPAPDFKGLAVVDNSFQE 61
            |:|.|| .:...|::..|..:...:.|...|..:.  ::||    |.|.||.|||.|||:..|:|
 Frog    10 SWVRRSGRLAGSPVLRNAAAATPSRCAIHKLQFST--SSVRFLPAVTQHAPHFKGTAVVNGEFKE 72

  Fly    62 VKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRK 126
            :.||||:|||||||||||||||||||||||||.:..||||:|.||:.|||||||.||.|.|..||
 Frog    73 LSLEDYKGKYLVLFFYPLDFTFVCPTEIVAFSNKANEFHDVNCEVVAVSVDSHFCHLAWTNTPRK 137

  Fly   127 NGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLR 191
            :||:||:..||||||.|:||.||.|||:..||:|||.||||||||::..|:|||||||||:|.||
 Frog   138 SGGLGQMNIPLLSDLNKQISRDYGVLLETPGIALRGLFIIDPNGIIKHMSVNDLPVGRSVEETLR 202

  Fly   192 LIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSK 232
            |:|||||||.|||||||||.|:|  .||||..|.||.||.|
 Frog   203 LVKAFQFVETHGEVCPANWTPDS--PTIKPSPEGSKDYFEK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 136/197 (69%)
PRX_Typ2cys 42..212 CDD:239313 122/169 (72%)
1-cysPrx_C 195..232 CDD:287400 26/36 (72%)
prdx3NP_001025608.1 PRX_Typ2cys 53..224 CDD:239313 122/170 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4944
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR42801
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.