DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and prdx4

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001082894.1 Gene:prdx4 / 570477 ZFINID:ZDB-GENE-030131-1096 Length:260 Species:Danio rerio


Alignment Length:202 Identity:120/202 - (59%)
Similarity:151/202 - (74%) Gaps:6/202 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LHQTAPLAAVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSER 95
            ||    |:..::.:|||.::|.||::..|:|:||.||:|||||.|||||||||||||||:|||:|
Zfish    63 LH----LSKAKISKPAPHWEGTAVINGEFKELKLSDYKGKYLVFFFYPLDFTFVCPTEIIAFSDR 123

  Fly    96 IKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISL 160
            :.||..||.||:..||||.|:||.|.|..||.||:|.:|.|||||||.:||.||.|.|:.:|.:|
Zfish   124 VHEFQAINAEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVFLEDQGHTL 188

  Fly   161 RGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEE 225
            ||.||||..|:|||.::|||||||||||.|||::|||:.::|||||||.|.|.|:  ||.||...
Zfish   189 RGLFIIDGKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSD--TIIPDPAG 251

  Fly   226 SKKYFSK 232
            ..|||.|
Zfish   252 KLKYFDK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 117/193 (61%)
PRX_Typ2cys 42..212 CDD:239313 107/169 (63%)
1-cysPrx_C 195..232 CDD:287400 20/36 (56%)
prdx4NP_001082894.1 PTZ00253 68..256 CDD:140280 114/189 (60%)
PRX_Typ2cys 70..241 CDD:239313 107/170 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.