DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and Jafrac1

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster


Alignment Length:190 Identity:110/190 - (57%)
Similarity:141/190 - (74%) Gaps:2/190 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTE 105
            ::|:|||.|.|.|||:..|:::||.||:|||||||||||||||||||||:||||...||..||.|
  Fly     3 QLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCE 67

  Fly   106 VLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNG 170
            |:|.|.||.|:||.|.|..||.||:|.:..|||:|.:.|::.||.||.::.||..||.||||...
  Fly    68 VIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQ 132

  Fly   171 ILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYF 230
            .|||.::|||||||||:|.|||::|||:.:::||||||||.|...  |:..|..:||:||
  Fly   133 NLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQK--TMVADPTKSKEYF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 110/190 (58%)
PRX_Typ2cys 42..212 CDD:239313 103/169 (61%)
1-cysPrx_C 195..232 CDD:287400 18/36 (50%)
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 103/170 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473004
Domainoid 1 1.000 99 1.000 Domainoid score I358
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I1131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113940at50557
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - otm51377
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
109.700

Return to query results.
Submit another query.