DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and Jafrac2

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001261350.1 Gene:Jafrac2 / 53577 FlyBaseID:FBgn0040308 Length:242 Species:Drosophila melanogaster


Alignment Length:202 Identity:122/202 - (60%)
Similarity:150/202 - (74%) Gaps:3/202 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HQTAPLAAVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERI 96
            ||.....|| :.:|||.|:|.|||:....::.|..|.|||:||.||||||||||||||:|||:||
  Fly    43 HQLQYTKAV-ISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRI 106

  Fly    97 KEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLR 161
            .||..|.|||:||||||||:||.|.|..||.||:|.:|.|||||||.|||.||.|.|:..|.:||
  Fly   107 AEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALR 171

  Fly   162 GTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEES 226
            |.||||..|:|||.::|||||||||||.:||::|||:.:.|||||||.|.|.::  ||.|:.||.
  Fly   172 GLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGAD--TIVPNPEEK 234

  Fly   227 KKYFSKH 233
            .|||:|:
  Fly   235 TKYFAKN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 118/192 (61%)
PRX_Typ2cys 42..212 CDD:239313 108/169 (64%)
1-cysPrx_C 195..232 CDD:287400 20/36 (56%)
Jafrac2NP_001261350.1 PRX_Typ2cys 52..223 CDD:239313 108/170 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473003
Domainoid 1 1.000 173 1.000 Domainoid score I1120
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I1131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113940at50557
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - otm51377
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
109.700

Return to query results.
Submit another query.