DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and PRDX1

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001189360.1 Gene:PRDX1 / 5052 HGNCID:9352 Length:199 Species:Homo sapiens


Alignment Length:193 Identity:118/193 - (61%)
Similarity:149/193 - (77%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVQQPAPDFKGLAVV-DNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINT 104
            ::..|||:||..||: |..|:::.|.||:|||:|.|||||||||||||||:|||:|.:||..:|.
Human     7 KIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNC 71

  Fly   105 EVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPN 169
            :|:|.||||||.||.|.|..:|.||:|.:..||:||..:.|:.||.||...||||.||.||||..
Human    72 QVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDK 136

  Fly   170 GILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSK 232
            |||||.::|||||||||||.|||::||||.::|||||||.|.|.|:  ||||||::||:||||
Human   137 GILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSD--TIKPDVQKSKEYFSK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 118/193 (61%)
PRX_Typ2cys 42..212 CDD:239313 104/170 (61%)
1-cysPrx_C 195..232 CDD:287400 24/36 (67%)
PRDX1NP_001189360.1 PRX_Typ2cys 8..180 CDD:239313 104/171 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..199 15/24 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10797
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.