DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and prdx4

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001006812.1 Gene:prdx4 / 448526 XenbaseID:XB-GENE-976761 Length:271 Species:Xenopus tropicalis


Alignment Length:275 Identity:129/275 - (46%)
Similarity:167/275 - (60%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFVARSLIRNVPLMGKAIL--------------SQQKQ-------------------------- 25
            |:.:.|..:|..|::|..:|              .:|.|                          
 Frog     1 MAVLLRHYLRGSPVLGLCLLLLSAAAVTCEPQEEKEQPQGRPGRAAPDGECHFYAGGQVYPGEAT 65

  Fly    26 ---IAARLLHQTAPLAAVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPT 87
               ::...||    |:..::.:|||.::|.||::..|:|:||.||:|||||.|||||||||||||
 Frog    66 RVPVSDHSLH----LSKAKISKPAPYWEGTAVINGEFKELKLTDYKGKYLVFFFYPLDFTFVCPT 126

  Fly    88 EIVAFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVL 152
            ||:||.:||:||..|||||:..||||.|:||.|.|..||.||:|.:|.|||||||.:||.||.|.
 Frog   127 EIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRKQGGLGPMKIPLLSDLTHQISKDYGVY 191

  Fly   153 LDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPA 217
            |:.:|.:|||.||||..|:|||.::|||||||||||.|||::|||:.:.|||||||.|.|.|.  
 Frog   192 LEDQGHTLRGLFIIDDKGVLRQITMNDLPVGRSVDETLRLVQAFQYTDTHGEVCPAGWKPGSE-- 254

  Fly   218 TIKPDVEESKKYFSK 232
            ||.||.....|||.|
 Frog   255 TIIPDPAGKLKYFHK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 118/193 (61%)
PRX_Typ2cys 42..212 CDD:239313 108/169 (64%)
1-cysPrx_C 195..232 CDD:287400 20/36 (56%)
prdx4NP_001006812.1 PRX_Typ2cys 81..252 CDD:239313 108/170 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.