DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and CG6888

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster


Alignment Length:194 Identity:98/194 - (50%)
Similarity:131/194 - (67%) Gaps:3/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINT 104
            :.:.|.||:|...|||...::...|.|.||:|::|.|||.||::|||||:.|||:|..||.::..
  Fly     4 LNINQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGC 68

  Fly   105 EVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPN 169
            |||..|.||||.|..|.|..|||||:|:|..|||:|...||:.||.||.:..|::||..||||..
  Fly    69 EVLACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDRE 133

  Fly   170 GILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSKH 233
            |.:||.::||:.|||||||.|||::||||.::.|||||.||.|.:.  |:|.|....::|| ||
  Fly   134 GRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAK--TMKADATGKEEYF-KH 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 96/192 (50%)
PRX_Typ2cys 42..212 CDD:239313 90/169 (53%)
1-cysPrx_C 195..232 CDD:287400 17/36 (47%)
CG6888NP_648759.1 AhpC 3..194 CDD:223527 96/192 (50%)
PRX_Typ2cys 6..177 CDD:239313 90/170 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473005
Domainoid 1 1.000 99 1.000 Domainoid score I358
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I247
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - otm51377
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
109.700

Return to query results.
Submit another query.