DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx3 and prdx2

DIOPT Version :9

Sequence 1:NP_524387.1 Gene:Prx3 / 42109 FlyBaseID:FBgn0038519 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_989001.1 Gene:prdx2 / 394597 XenbaseID:XB-GENE-945852 Length:206 Species:Xenopus tropicalis


Alignment Length:191 Identity:115/191 - (60%)
Similarity:150/191 - (78%) Gaps:2/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEV 106
            :.||||.||..|||:..|::::|.||.|||:|||||||||||||||||:|||:...:|..||.::
 Frog    16 IGQPAPAFKATAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQL 80

  Fly   107 LGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGI 171
            :.|||||.|:||.|.||.||.||:|.:..||:||||..|:.||.||.:::|::.||.||||..|.
 Frog    81 IAVSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKGN 145

  Fly   172 LRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSK 232
            |||.:||||||||||:|.|||::|||:.:||||||||.|.|.|  :||||:|::||::|||
 Frog   146 LRQITINDLPVGRSVEETLRLVQAFQYTDQHGEVCPAGWKPGS--STIKPNVKDSKEFFSK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx3NP_524387.1 AhpC 40..233 CDD:223527 115/191 (60%)
PRX_Typ2cys 42..212 CDD:239313 103/169 (61%)
1-cysPrx_C 195..232 CDD:287400 22/36 (61%)
prdx2NP_989001.1 PRX_Typ2cys 16..187 CDD:239313 103/170 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11014
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.